Recombinant Human Anterior Gradient Protein 3 Homolog/AG-3/BCMP11/AGR3 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, 2mM EDTA, pH 8.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | IAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSELVDHHHHHH |
Source: Human Cells.
MW :18.04kD.
Recombinant Human Anterior Gradient Protein 3 Homolog is produced by our Mammalian expression system and the target gene encoding Ile22-Leu166 is expressed with a 6His tag at the C-terminus. Anterior Gradient Protein 2(AG-2) and Anterior Gradient Protein 3 (AG-3) are human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan (hAG-3 protein). AG-3 could serve as a prognostic marker for survival in patients with low grade and high grade serous ovarian carcinomas.
MW :18.04kD.
Recombinant Human Anterior Gradient Protein 3 Homolog is produced by our Mammalian expression system and the target gene encoding Ile22-Leu166 is expressed with a 6His tag at the C-terminus. Anterior Gradient Protein 2(AG-2) and Anterior Gradient Protein 3 (AG-3) are human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan (hAG-3 protein). AG-3 could serve as a prognostic marker for survival in patients with low grade and high grade serous ovarian carcinomas.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum |
| Tissue Specificity: | Expressed in the lung, in the ciliated cells of the airway epithelium (PubMed:25751668). Expression increased with differentiation of airway epithelial cells (PubMed:25751668). Not detected in the mucous cells (PubMed:25751668). Expressed in ciliated cells in the oviduct (PubMed:26170690). Also detected in stomach, colon, prostate and liver (PubMed:25751668). Expressed in breast, ovary, prostate and liver cancer (PubMed:26170690). Expression is associated with the level of differentiation of breast cancer (at protein level) (PubMed:26170690). |
| BioGrid: | 127586. 17 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
