Recombinant Human Angiopoietin-Like Protein 8/ANGPTL8/Betatrophin (C-6His)(Discontinued)

Product code: 32-8309

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 10 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl, pH 8.0.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPALEHHHHHH
Gene : ANGPTL8
Gene ID : 55908
Uniprot ID : Q6UXH0

Source: E.coli.
MW :21.1kD.
Recombinant Human Angiopoietin-like protein 8 is produced by our E.coli expression system and the target gene encoding Ala22-Ala198 is expressed with a 6His tag at the C-terminus. The protein specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. It promotes pancreatic beta cell proliferation without insulin resistance. Also it acts as a blood lipid regulator by regulating serum triglyceride levels and possibly by promoting ANGPTL3 cleavage. It interacts with ANGPTL3. It predominantly expressed in liver and also expressed in adipose tissues. The ability of the protein to induce pancreatic beta cell proliferation is promising in diabetes therapy. Betatrophin treatment could supply or replace insulin injections by increasing the number of insulin-producing cells in diabetes.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
Post transnational modification: Proteolytically cleaved at the N-terminus.
Tissue Specificity: Predominantly expressed in liver. Also expressed in adipose tissues.
BioGrid: 120994. 1 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products