Recombinant Human Aminopeptidase P2/XPNPEP2 (C-6His)(Discontinued)

Product code: 32-7461

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : HTKPVDLGGQDVRNCSTNPPYLPVTVVNTTMSLTALRQQMQTQNLSAYIIPGTDAHMNEYIGQHDERRAWITGFTGSAGTAVVTMKKAAVWTDSRYWTQAERQMDCNWELHKEVGTTPIVTWLLTEIPAGGRVGFDPFLLSIDTWESYDLALQGSNRQLVSITTNLVDLVWGSERPPVPNQPIYALQEAFTGSTWQEKVSGVRSQMQKHQKVPTAVLLSALEETAWLFNLRASDIPYNPFFYSYTLLTDSSIRLFANKSRFSSETLSYLNSSCTGPMCVQIEDYSQVRDSIQAYSLGDVRIWIGTSYTMYGIYEMIPKEKLVTDTYSPVMMTKAVKNSKEQALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFSSGPSFETISASGLNAALAHYSPTKELNRKLSSDEMYLLDSGGQYWDGTTDITRTVHWGTPSAFQKEAYTRVLIGNIDLSRLIFPAATSGRMVEAFARRALWDAGLNYGHGTGHGIGNFLCVHEWPVGFQSNNIAMAKGMFTSIEPGYYKDGEFGIRLEDVALVVEAKTKYPGSYLTFEVVSFVPYDRNLIDVSLLSPEHLQYLNRYYQTIREKVGPELQRRQLLEEFEWLQQHTEPLAAHHHHHH
Gene : XPNPEP2
Gene ID : 7512
Uniprot ID : O43895
Source: Human Cells.
MW :71.64kD.
Recombinant Human Aminopeptidase P2 is produced by our Mammalian expression system and the target gene encoding His22-Ala650 is expressed with a 6His tag at the C-terminus. Xaa-Pro aminopeptidase 2 (XPNPEP2) belongs to the peptidase M24B family of metalloproteases. Human XPNPEP2 is widely expressed in various tissues, such as kidney, lung, heart, placenta, liver, small intestine and colon. However, it doesnÂ’t express in brain, skeletal muscle, pancreas, spleen, thymus, prostate, testis and ovary. XPNPEP2 is a Homotrimer which binds 2 manganese ions per subunit. The metalloprotease XPNPEP2 may play a role in the inflammatory process and other reactions produced in response to injury or infection and the metabolism of the vasodilator bradykinin.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cell membrane
Post transnational modification: N-glycosylated.
Tissue Specificity: Expressed in kidney, lung, heart, placenta, liver, small intestine and colon. No expression in brain, skeletal muscle, pancreas, spleen, thymus, prostate, testis and ovary.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products