Recombinant Human Alpha 1-Microglobulin/AMBP (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVVDHHHHHH |
Source: Human Cells.
MW :21.9kD.
Recombinant Human alpha 1-Microglobulin is produced by our Mammalian expression system and the target gene encoding Gly20-Val203 is expressed with a 6His tag at the C-terminus. Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: a-1-microglobulin, inter-a-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. a-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-a-trypsin inhibitor is present in the plasma and urine. a-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-a-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.
MW :21.9kD.
Recombinant Human alpha 1-Microglobulin is produced by our Mammalian expression system and the target gene encoding Gly20-Val203 is expressed with a 6His tag at the C-terminus. Protein AMBP belongs to the calycin superfamily and Lipocalin family. AMBP can be cleaved into three chains: a-1-microglobulin, inter-a-trypsin inhibitor light chain and trypstatin. AMBP is expressed by the liver and secreted in plasma. a-1-microglobulin occurs in many physiological fluids including the plasma, urine, and cerebrospinal fluid. Inter-a-trypsin inhibitor is present in the plasma and urine. a-1-microglobulin occurs as a monomer and also in complexes with IgA and albumin, Inter-a-trypsin inhibitor inhibits trypsin, plasmin and lysosomal granulocytic elastase. Trypstatin act as a trypsin inhibitor, exists in a monomer forms and also occurs as a complex with tryptase in mast cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N- and O-glycosylated. N-glycan heterogeneity at Asn-115: Hex5HexNAc4 (major), Hex6HexNAc5 (minor) and dHex1Hex6HexNAc5 (minor). N-glycan at Asn-250: Hex5HexNAc4. O-linkage of the glycosaminoglycan, chondroitin sulfate, at Ser-215 allows cross-linking between the three polypeptide chains. |
| Tissue Specificity: | Expressed by the liver and secreted in plasma. Alpha-1-microglobulin occurs in many physiological fluids including plasma, urine, and cerebrospinal fluid. Inter-alpha-trypsin inhibitor is present in plasma and urine. |
| BioGrid: | 106757. 13 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
