Recombinant Human Allograft Inflammatory Factor 1/AIF1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELPLEHHHHHH |
Source: E. coli.
MW :17.7kD.
Recombinant Human Allograft Inflammatory Factor 1 is produced by our E.coli expression system and the target gene encoding Ser2-Pro147 is expressed with a 6His tag at the C-terminus. Allograft Inflammatory Factor 1 (AIF1) contains two EF-hand domains and exists as a homodimer. AIF1 can be detected in T-lymphocytes and peripheral blood mononuclear cells. AIF1 functions as actin-binding protein that enhances membrane ruffling and RAC activation and can enhance the actin-bundling activity of LCP1. In addition, AIF1 plays a role in RAC signaling and in phagocytosis and may also in macrophage activation and function. AIF1 promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes and plays a role in vascular inflammation.
MW :17.7kD.
Recombinant Human Allograft Inflammatory Factor 1 is produced by our E.coli expression system and the target gene encoding Ser2-Pro147 is expressed with a 6His tag at the C-terminus. Allograft Inflammatory Factor 1 (AIF1) contains two EF-hand domains and exists as a homodimer. AIF1 can be detected in T-lymphocytes and peripheral blood mononuclear cells. AIF1 functions as actin-binding protein that enhances membrane ruffling and RAC activation and can enhance the actin-bundling activity of LCP1. In addition, AIF1 plays a role in RAC signaling and in phagocytosis and may also in macrophage activation and function. AIF1 promotes the proliferation of vascular smooth muscle cells and of T-lymphocytes and plays a role in vascular inflammation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cell projection, Cell projection |
| Post transnational modification: | Phosphorylated on serine residues. |
| Tissue Specificity: | Detected in T-lymphocytes and peripheral blood mononuclear cells. |
| BioGrid: | 106702. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
