Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
Source: E.coli.
MW :36.74kD.
Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed. Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) plays a role in concert with the 5-a/5- beta-Steroid Reductases to convert Steroid hormones into the 3-a/5-a and 3-a/5- beta-Tetrahydrosteroids. AKR1C2 catalyzes the inactivation of the most potent androgen 5-a-Dihydrotestosterone (5-a-DHT) to 5-a-Androstane-3-a, 17- beta-diol (3-a-diol).
MW :36.74kD.
Recombinant Human Aldo-Keto Reductase 1C3 is produced by our E.coli expression system and the target gene encoding Met1-Tyr323 is expressed. Aldo-Keto Reductase Family 1 Member C2 (AKR1C2) plays a role in concert with the 5-a/5- beta-Steroid Reductases to convert Steroid hormones into the 3-a/5-a and 3-a/5- beta-Tetrahydrosteroids. AKR1C2 catalyzes the inactivation of the most potent androgen 5-a-Dihydrotestosterone (5-a-DHT) to 5-a-Androstane-3-a, 17- beta-diol (3-a-diol).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Expressed in fetal testes. Expressed in fetal and adult adrenal glands. |
| BioGrid: | 108013. 13 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
