Recombinant Human Adaptin Ear-Binding Coat-Associated Protein 2/NECAP2 (N, C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQFLEHHHHHH |
Source: E. coli.
MW :31.5kD.
Recombinant Human NECAP2 is produced by our E.coli expression system and the target gene encoding Met1-Phe263 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. NECAP2 belongs to the NECAP family. The WXXF motifs mediate binding of accessory proteins to the ear-domain of AP-1, GGAs and AP-2 through hydrophobic interactions. Adaptin ear-binding coat-associated protein 2 can interacts with AP1G1 and AP2A1 components of the adapter protein complex AP-1 and AP-2. It also interacts with the GAE domain proteins GGA1, GGA2 and GGA3.
MW :31.5kD.
Recombinant Human NECAP2 is produced by our E.coli expression system and the target gene encoding Met1-Phe263 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. NECAP2 belongs to the NECAP family. The WXXF motifs mediate binding of accessory proteins to the ear-domain of AP-1, GGAs and AP-2 through hydrophobic interactions. Adaptin ear-binding coat-associated protein 2 can interacts with AP1G1 and AP2A1 components of the adapter protein complex AP-1 and AP-2. It also interacts with the GAE domain proteins GGA1, GGA2 and GGA3.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasmic vesicle, Cell membrane |
| BioGrid: | 120832. 32 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
