Recombinant Human Activin Receptor 1A/Activin RI/ALK-2/ACVR1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVVDHHHHHH |
Source: Human Cells.
MW :12.6kD.
Recombinant Human Activin Receptor IA is produced by our Mammalian expression system and the target gene encoding Met21-Val124 is expressed with a 6His tag at the C-terminus. Activin receptor type-1, also known as Activin receptor type I, Activin receptor-like kinase 2, Serine/threonine-protein kinase receptor R1, TGF-B superfamily receptor type I, ACVRLK2 and ACVR1, is a single-pass type I membrane protein. ACVR1 is expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. ACVR1 belongs to the protein kinase superfamily. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 signals a particular transcriptional response in concert with activin type II receptors.
MW :12.6kD.
Recombinant Human Activin Receptor IA is produced by our Mammalian expression system and the target gene encoding Met21-Val124 is expressed with a 6His tag at the C-terminus. Activin receptor type-1, also known as Activin receptor type I, Activin receptor-like kinase 2, Serine/threonine-protein kinase receptor R1, TGF-B superfamily receptor type I, ACVRLK2 and ACVR1, is a single-pass type I membrane protein. ACVR1 is expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. ACVR1 belongs to the protein kinase superfamily. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. ACVR1 signals a particular transcriptional response in concert with activin type II receptors.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Expressed in normal parenchymal cells, endothelial cells, fibroblasts and tumor-derived epithelial cells. |
| BioGrid: | 106605. 71 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
