Recombinant Human Acrosomal Protein SP-10/ACRV1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKIVDHHHHHH |
Source: Human Cells.
MW :26.9kD.
Recombinant Human Acrosomal Protein SP-10 is produced by our Mammalian expression system and the target gene encoding Gln22-Ile265 is expressed with a 6His tag at the C-terminus. Acrosomal Protein SP-10 is a testis-specific differentiation antigen that is associated with acrosomal membranes and matrix of mature sperm. It has been detected in several species including humans. Acrosomal Protein SP-10 may be involved in sperm-zona binding or penetration as a potential contraceptive vaccine immunogen for humans. ACRV1 is also a intra-acrosomal protein that is considered to be a vaccine candidate for immunocontraception.
MW :26.9kD.
Recombinant Human Acrosomal Protein SP-10 is produced by our Mammalian expression system and the target gene encoding Gln22-Ile265 is expressed with a 6His tag at the C-terminus. Acrosomal Protein SP-10 is a testis-specific differentiation antigen that is associated with acrosomal membranes and matrix of mature sperm. It has been detected in several species including humans. Acrosomal Protein SP-10 may be involved in sperm-zona binding or penetration as a potential contraceptive vaccine immunogen for humans. ACRV1 is also a intra-acrosomal protein that is considered to be a vaccine candidate for immunocontraception.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasmic vesicle |
| Tissue Specificity: | Testis. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
