Recombinant Human a-Taxilin/TXLNA (N, C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH |
Source: E. coli.
MW :20.4kD.
Recombinant Human alpha-Taxilin is produced by our E.coli expression system and the target gene encoding Met1-Lys162 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. a-Taxilin belongs to the taxilin family. a-Taxilin exists in almost all tissues, with higher expression levels observed in the heart, kidney, liver, and pancreas. a-Taxilin binds to the C-terminal coiled coil region of syntaxin family members STX1A, STX3A, and STX4A, but not when these proteins are complexed with SNAP25, VAMP2 or STXBP1, suggesting that it interacts with syntaxins that do not form the SNARE complex. It is shown that a-Taxilin plays multiple roles in the generation and maintenance of neurons through modulation of the NAC-mediated translational machinary and/or the syntaxin-mediated vesicle traffic in the soma. In addition, a-Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.
MW :20.4kD.
Recombinant Human alpha-Taxilin is produced by our E.coli expression system and the target gene encoding Met1-Lys162 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. a-Taxilin belongs to the taxilin family. a-Taxilin exists in almost all tissues, with higher expression levels observed in the heart, kidney, liver, and pancreas. a-Taxilin binds to the C-terminal coiled coil region of syntaxin family members STX1A, STX3A, and STX4A, but not when these proteins are complexed with SNAP25, VAMP2 or STXBP1, suggesting that it interacts with syntaxins that do not form the SNARE complex. It is shown that a-Taxilin plays multiple roles in the generation and maintenance of neurons through modulation of the NAC-mediated translational machinary and/or the syntaxin-mediated vesicle traffic in the soma. In addition, a-Taxilin may be involved in intracellular vesicle traffic and potentially in calcium-dependent exocytosis in neuroendocrine cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Tissue Specificity: | Ubiquitous, with much higher expression in heart, kidney, liver and pancreas. |
| BioGrid: | 128297. 118 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
