Recombinant Human 6-O-Methylguanine-DNA Methyltransferase/MGMT (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mMTrisHCl,1mM EDTA, pH 8.0 . |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
Source: E. coli.
MW :23.8kD.
Recombinant Human MGMT is produced by our E.coli expression system and the target gene encoding Met1-Asn207 is expressed with a 6His tag at the N-terminus. MGMT belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. MGMT involved in the cellular defense against the biological effects of O6-methylguanine in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. MGMT catalyzes the chemical reaction: DNA (containing 6-O-methylguanine) and proteinL-cysteine into DNA (without 6-O-methylguanine) and protein S-methyl-L-cysteine.
MW :23.8kD.
Recombinant Human MGMT is produced by our E.coli expression system and the target gene encoding Met1-Asn207 is expressed with a 6His tag at the N-terminus. MGMT belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. MGMT involved in the cellular defense against the biological effects of O6-methylguanine in DNA. Repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme. MGMT catalyzes the chemical reaction: DNA (containing 6-O-methylguanine) and proteinL-cysteine into DNA (without 6-O-methylguanine) and protein S-methyl-L-cysteine.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus |
| BioGrid: | 110411. 74 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
