Recombinant Human 15-PGDH/HPGD (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM HEPES,150mM NaCl,pH7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQVDHHHHHH |
Source: Human Cells.
MW :30kD.
Recombinant Human HPGD is produced by our Mammalian expression system and the target gene encoding Met1-Gln266 is expressed with a 6His tag at the C-terminus. 15-hydroxyprostaglandin dehydrogenase [NAD(+)], also known as Prostaglandin dehydrogenase 1, 15-PGDH, HPGD and PGDH1, belongs to the short-chain dehydrogenases/reductases (SDR) family. HPGD localizes to the cytoplasm and can be found in colon epithelium, existing as a homodimer. HPGD catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. HPGD is down-regulated by cortisol, dexamethasone and betamethasone, up-regulated by TGFB1. HPGD inhibits in vivo proliferation of colon cancer cells. HPGD is the key enzyme for the inactivation of prostaglandins, and thus regulates processes such as inflammation or proliferation.
MW :30kD.
Recombinant Human HPGD is produced by our Mammalian expression system and the target gene encoding Met1-Gln266 is expressed with a 6His tag at the C-terminus. 15-hydroxyprostaglandin dehydrogenase [NAD(+)], also known as Prostaglandin dehydrogenase 1, 15-PGDH, HPGD and PGDH1, belongs to the short-chain dehydrogenases/reductases (SDR) family. HPGD localizes to the cytoplasm and can be found in colon epithelium, existing as a homodimer. HPGD catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. HPGD is down-regulated by cortisol, dexamethasone and betamethasone, up-regulated by TGFB1. HPGD inhibits in vivo proliferation of colon cancer cells. HPGD is the key enzyme for the inactivation of prostaglandins, and thus regulates processes such as inflammation or proliferation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Detected in colon epithelium (at protein level). |
| BioGrid: | 109485. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
