Recombinant E. coli 4'-Phosphopantetheinyl Transferase ACPS (C-6His)(Discontinued)

Product code: 32-8304

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : AILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVANMHVTLADERHYACATVIIESLEHHHHHH
Gene : acpS
Gene ID : 947037
Uniprot ID : P24224
Source: E. coli.
MW :15.1kD.
Recombinant E.coli 4'-phosphopantetheinyl transferase AcpS is produced by our E.coli expression system and the target gene encoding Ala2-Ser126 is expressed with a 6His tag at the C-terminus. Holo-[acyl-carrier-protein] synthase is an enzyme that belongs to the P-Pant transferase superfamily.AcpS family.It transfers the 4'-phosphopantetheine moiety from coenzyme A to the 'Ser-36' of acyl-carrier-protein.It catalyzes the chemical reaction: CoA-[4'-phosphopantetheine] + apo-acyl carrier protein adenosine 3',5'-bisphosphate + holo-acyl carrier protein. This enzyme participates in pantothenate and coa biosynthesis.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Cytoplasm
BioGrid: 4260598. 286 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products