Recombinant E. coli 4'-Phosphopantetheinyl Transferase ACPS(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris, 150mM NaCl, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AILGLGTDIVEIARIEAVIARSGDRLARRVLSDNEWAIWKTHHQPVRFLAKRFAVKEAAAKAFGTGIRNGLAFNQFEVFNDELGKPRLRLWGEALKLAEKLGVANMHVTLADERHYACATVIIES |
Source: E. coli.
MW :14.1kD.
Recombinant E.coli 4'-phosphopantetheinyl transferase AcpS is produced by our E.coli expression system and the target gene encoding Ala2-Ser126 is expressed. Holo-[acyl-carrier-protein] synthase is an enzyme that belongs to the P-Pant transferase superfamily.AcpS family.It transfers the 4'-phosphopantetheine moiety from coenzyme A to the 'Ser-36' of acyl-carrier-protein.It catalyzes the chemical reaction: CoA-[4'-phosphopantetheine] + apo-acyl carrier protein adenosine 3',5'-bisphosphate + holo-acyl carrier protein. This enzyme participates in pantothenate and coa biosynthesis.
MW :14.1kD.
Recombinant E.coli 4'-phosphopantetheinyl transferase AcpS is produced by our E.coli expression system and the target gene encoding Ala2-Ser126 is expressed. Holo-[acyl-carrier-protein] synthase is an enzyme that belongs to the P-Pant transferase superfamily.AcpS family.It transfers the 4'-phosphopantetheine moiety from coenzyme A to the 'Ser-36' of acyl-carrier-protein.It catalyzes the chemical reaction: CoA-[4'-phosphopantetheine] + apo-acyl carrier protein adenosine 3',5'-bisphosphate + holo-acyl carrier protein. This enzyme participates in pantothenate and coa biosynthesis.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| BioGrid: | 4260598. 286 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
