Recombinant Cynomolgus CD3d / CD3 delta Protein (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | FKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLAHHHHHH |
Source: Human Cells.
MW :10.4kD.
Recombinant Cynomolgus T-cell Surface Glycoprotein CD3 Delta Chain protein is produced by our Mammalian expression system and the target gene encoding Phe22-Ala105 is expressed with a 6His tag at the C-terminus. T-cell surface glycoprotein CD3 delta chain (CD3D) is a single-pass type I membrane protein. CD3D, together with CD3-gamma, CD3-epsilon and CD3-zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. CD3 chains are present as CD3gammaepsilon, deltaepsilon, and zetazeta dimers in the receptor complex and play critical roles in the antigen receptor assembly, transport to the cell surface, and the receptor-mediated signal transduction. T cell receptor-CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs(ITAMs). CD3D contains 1 ITAM domain and has been shown to interact with CD8A.
MW :10.4kD.
Recombinant Cynomolgus T-cell Surface Glycoprotein CD3 Delta Chain protein is produced by our Mammalian expression system and the target gene encoding Phe22-Ala105 is expressed with a 6His tag at the C-terminus. T-cell surface glycoprotein CD3 delta chain (CD3D) is a single-pass type I membrane protein. CD3D, together with CD3-gamma, CD3-epsilon and CD3-zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T cell receptor-CD3 complex. CD3 chains are present as CD3gammaepsilon, deltaepsilon, and zetazeta dimers in the receptor complex and play critical roles in the antigen receptor assembly, transport to the cell surface, and the receptor-mediated signal transduction. T cell receptor-CD3 complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. This complex is critical for T-cell development and function, and represents one of the most complex transmembrane receptors. The T cell receptor-CD3 complex is unique in having ten cytoplasmic immunoreceptor tyrosine-based activation motifs(ITAMs). CD3D contains 1 ITAM domain and has been shown to interact with CD8A.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on Tyr residues after T-cell receptor triggering by LCK in association with CD4/CD8. |
| Tissue Specificity: | CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
