Recombinant Carassius Auratus Leptin (N-8His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC |
| Gene : | ob |
| Uniprot ID : | B8YI02 |
Source: E.coli.
MW :18.3kD.
Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus. Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. In mammals, leptin is mainly produced by the adipose tissue and encodes body fat reserves, acting as a short-term satiety signal. In fish, the presence of a leptin-like peptide was first evidenced by immuno-cross-reactivity [14], and its existence was certainly demonstrated after the finding by synteny of a leptin sequence in the pufferfish.
MW :18.3kD.
Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus. Leptin is a hormone secreted from white adipocytes and plays important role in the regulation of food intake and energy balance. Leptin functions via signaling pathways involving OB-R in hypothalamus. In mammals, leptin is mainly produced by the adipose tissue and encodes body fat reserves, acting as a short-term satiety signal. In fish, the presence of a leptin-like peptide was first evidenced by immuno-cross-reactivity [14], and its existence was certainly demonstrated after the finding by synteny of a leptin sequence in the pufferfish.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
