Protein S100-A13/S100A13
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK |
Source: E.coli.
MW :11.3kD.
Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed S100A13 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. It is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. It plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. It binds two calcium ions per subunit and one copper ion. Binding of one copper ion does not interfere with calcium binding. It is required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.
MW :11.3kD.
Recombinant Human Protein S100-A13 is produced by our expression system and the target gene encoding Ala2-Lys98 is expressed S100A13 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. It is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. It plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. It binds two calcium ions per subunit and one copper ion. Binding of one copper ion does not interfere with calcium binding. It is required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH3O. Please aliquot the reconstituted solution to
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Secreted |
| Tissue Specificity: | Expressed in heart and skeletal muscle. |
| BioGrid: | 112192. 20 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
