Mouse Interleukin-19 (AF)

Product code: 32-12199

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  100 µg

  • $430.00 

  • $1,046.00 

Add to Wish List

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 100 µg
Purification : Reducing and Non-Reducing SDS PAGE at >= 95%
Content : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 50 mM sodium chloride, pH 7.5
Sterile water at 0.1 mg/mL
Storage condition : Store at -20°C
AA sequence : MLRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA
Gene : Il19
Gene ID : 329244
Uniprot ID : Q8CJ70
Source: Genetically modified E.coli.
Predicted MW: Monomer, 17.7 kDa (153 aa)
Interleukin-19 (IL-19) is a member of the interleukin 10 (IL-10) cytokine family and is produced by B cells and monocytes.  IL-19 binds the interleukin 20 receptor complex (IL-20R) to activate STAT3 signaling.  IL-19 induces interleukin 6 (IL-6) and tumor necrosis factor alpha (TNF-alpha) expression in monocytes, and promotes type 2 T helper (Th2) cell-mediated immune responses.  IL-19 production is upregulated in resting monocytes following granulocyte-macrophage colony-stimulating factor (GM-CSF) or lipopolysaccharide (LPS) stimulation. 

Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Centrifuge vial before opening, Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss.   

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products