Monoclonal Antibody to DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker)(DG1/447 + DOG-1.1)
![](product_image.php?photofile=images/36-1582/1.jpg)
Formalin-fixed, paraffin-embedded human GIST stained with DOG1 Monoclonal Antibody (DG1/447 + DOG1.1).
Roll over image to zoom in
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Format : | Purified |
Amount : | 100 µg |
Isotype : | Mouse IgG1, kappa + Mouse IgG1, kappa |
Purification : | Affinity Chromatography |
Content : | 100 µg in 500 µl PBS containing 0.05% BSA and 0.05% sodium azide. Sodium azide is highly toxic. |
Storage condition : | Store the antibody at 4°C; stable for 6 months. For long-term storage; store at -20°C. Avoid repeated freeze and thaw cycles. |
Gene : | ANO1 |
Gene ID : | 55107 |
Uniprot ID : | Q5XXA6 |
Alternative Name : | ANO1, DOG1, ORAOV2, TAOS2, TMEM16A |
Immunogen Information : | Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjµgated to a carrier protein (DOG-1.1). |
Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GISTs), c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors, which, due to appearance, may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GISTs, including all c-kit negative GISTs. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs, including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GISTs is nearly identical: 94.4% vs. 94.7%.
Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT)(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for 45 min at 95°C followed by cooling at RT for 20 minutes);
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane, Cytoplasm |
Tissue Specificity: | Broadly expressed with higher levels in liver, skeletal muscle and gastrointestinal muscles. |
BioGrid: | 120417. 1 interactions. |
There are currently no product reviews
|