Human Interleukin-35 Heterodimer
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 100 µg |
| Purification : | Reducing and Non-Reducing SDS PAGE at >= 95% |
| Content : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 30 mM sodium chloride, pH7.5 Sterile water at 0.1 mg/mL |
| Storage condition : | Store at -20°C |
| AA sequence : | EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK Â p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Gene : | EBI3 |
| Gene ID : | 10148 |
| Uniprot ID : | Q14213/P29459 |
| Alternative Name : | Interleukin-27 subunit beta, IL-27 subunit beta, Epstein-Barr virus-induced gene 3 protein, EBV-induced gene 3 protein |
Source: Genetically modified HEK 293 cells.
 Single chain dimer, 45.8/ 60-65 unreduced 70-80 reduced kDa (406 aa)
Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
 Single chain dimer, 45.8/ 60-65 unreduced 70-80 reduced kDa (406 aa)
Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
Endotoxin: Less than 0.5 ng/µg (1 IEU/µg) as determined by LAL test.
Centrifuge vial before opening, Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss.  Â
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
